Lineage for d6nmsc_ (6nms C:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (26 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1264 PDB entries)
  8. 3072704Domain d6nmsc_: 6nms C: [372766]
    Other proteins in same PDB: d6nmsa1, d6nmsa2, d6nmsl1, d6nmsl2
    automated match to d4cmma_

Details for d6nmsc_

PDB Entry: 6nms (more details), 2.11 Å

PDB Description: blocking fab 136 anti-sirp-alpha antibody in complex with sirp-alpha variant 1
PDB Compounds: (C:) tyrosine-protein phosphatase non-receptor type substrate 1

SCOPe Domain Sequences for d6nmsc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nmsc_ b.1.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eeelqviqpdksvlvaagetatlrctatslipvgpiqwfrgagpgreliynqkeghfprv
ttvsdltkrnnmdfsirigaitpadagtyycvkfrkgspddvefksgagtelsvrak

SCOPe Domain Coordinates for d6nmsc_:

Click to download the PDB-style file with coordinates for d6nmsc_.
(The format of our PDB-style files is described here.)

Timeline for d6nmsc_: