Lineage for d1bzqc_ (1bzq C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1890050Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 1890051Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 1890052Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 1890160Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)
  7. 1890161Species Cow (Bos taurus) [TaxId:9913] [54079] (177 PDB entries)
  8. 1890389Domain d1bzqc_: 1bzq C: [37272]
    Other proteins in same PDB: d1bzqk_, d1bzql_, d1bzqm_, d1bzqn_
    protein/RNA complex; complexed with po4

Details for d1bzqc_

PDB Entry: 1bzq (more details), 2.8 Å

PDB Description: complex of a dromedary single-domain vhh antibody fragment with rnase a
PDB Compounds: (C:) protein (RNAse a)

SCOPe Domain Sequences for d1bzqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bzqc_ d.5.1.1 (C:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

SCOPe Domain Coordinates for d1bzqc_:

Click to download the PDB-style file with coordinates for d1bzqc_.
(The format of our PDB-style files is described here.)

Timeline for d1bzqc_: