Lineage for d1bzqa_ (1bzq A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 324599Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 324600Superfamily d.5.1: RNase A-like [54076] (1 family) (S)
    can be classified as disulphide-rich
  5. 324601Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)
  6. 324661Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)
  7. 324662Species Cow (Bos taurus) [TaxId:9913] [54079] (117 PDB entries)
  8. 324801Domain d1bzqa_: 1bzq A: [37270]
    Other proteins in same PDB: d1bzqk_, d1bzql_, d1bzqm_, d1bzqn_

Details for d1bzqa_

PDB Entry: 1bzq (more details), 2.8 Å

PDB Description: complex of a dromedary single-domain vhh antibody fragment with rnase a

SCOP Domain Sequences for d1bzqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bzqa_ d.5.1.1 (A:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus)}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

SCOP Domain Coordinates for d1bzqa_:

Click to download the PDB-style file with coordinates for d1bzqa_.
(The format of our PDB-style files is described here.)

Timeline for d1bzqa_: