Lineage for d6pa0c_ (6pa0 C:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2629055Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 2629056Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) (S)
    Pfam PF00520
  5. 2629057Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 2629078Protein Potassium channel protein [56901] (3 species)
  7. 2629081Species Streptomyces coelicolor [TaxId:1902] [56902] (26 PDB entries)
    identical sequence to Streptomyces lividans, TaxId: 1916
    Uniprot Q54397 22-124
  8. 2629092Domain d6pa0c_: 6pa0 C: [372699]
    Other proteins in same PDB: d6pa0b1, d6pa0b2
    automated match to d1r3jc_
    complexed with dga, f09, na; mutant

Details for d6pa0c_

PDB Entry: 6pa0 (more details), 2.05 Å

PDB Description: structure of the g77a mutant in sodium chloride
PDB Compounds: (C:) pH-gated potassium channel KcsA

SCOPe Domain Sequences for d6pa0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pa0c_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvaygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh

SCOPe Domain Coordinates for d6pa0c_:

Click to download the PDB-style file with coordinates for d6pa0c_.
(The format of our PDB-style files is described here.)

Timeline for d6pa0c_: