SCOPe 2.08: Domain d6jx2d1: 6jx2 D:3-184

Lineage for d6jx2d1 (6jx2 D:3-184)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Corynebacterium glutamicum [TaxId:196627] [315006] (3 PDB entries)

8. Domain d6jx2d1: 6jx2 D:3-184 [372551]
   Other proteins in same PDB: d6jx2a2, d6jx2b2, d6jx2c2, d6jx2d2
   automated match to d4xiya1
   complexed with edo, mg, nap

Details for d6jx2d1

PDB Entry: 6jx2, 2.6 Å

PDB Description: crystal structure of ketol-acid reductoisomerase from corynebacterium glutamicum

PDB Compounds: (D:) Ketol-acid reductoisomerase (NADP(+))

SCOPe Domain Sequences for d6jx2d1:

Sequence; same for both SEQRES and ATOM records:

>d6jx2d1 c.2.1.0 (D:3-184) automated matches {Corynebacterium glutamicum [TaxId: 196627]}
iellydadadlsliqgrkvaivgygsqghahsqnlrdsgvevviglregsksaekakeag
fevkttaeaaawadvimllapdtsqaeiftndiepnlnagdallfghglnihfdlikpad
diivgmvapkgpghlvrrqfvdgkgvpcliavdqdptgtaqaltlsyaaaiggaragvip
tt

Timeline for d6jx2d1:

• d6jx2d1 first appeared in SCOPe 2.07