SCOPe 2.08: Domain d6raia2: 6rai A:337-597

Lineage for d6raia2 (6rai A:337-597)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:262724] [187453] (15 PDB entries)

8. Domain d6raia2: 6rai A:337-597 [372447]
   Other proteins in same PDB: d6raia1, d6raic_
   automated match to d5mkka2
   complexed with atp, mg

Details for d6raia2

PDB Entry: 6rai, 2.9 Å

PDB Description: heterodimeric abc exporter tmrab in atp-bound outward-facing occluded conformation

PDB Compounds: (A:) Multidrug resistance ABC transporter ATP-binding and permease protein

SCOPe Domain Sequences for d6raia2:

Sequence; same for both SEQRES and ATOM records:

>d6raia2 c.37.1.0 (A:337-597) automated matches {Thermus thermophilus [TaxId: 262724]}
lkdpedptpirgfrgevefrdvwlaytpkgveptekdwvlkgvsfrvrpgekvalvgatg
agktsvvsliarfydpqrgcvfldgvdvrryrqeelrrhvgivlqepflfsgtvldnlrl
fdpsvpperveevarflgahefilrlpkgyqtvlgergaglstgekqllalvrallaspd
illildqatasvdsetekrlqealykamegrtsliiahrlstirhvdrilvfrkgrlvee
gsheellakggyyaalyrlqf

Timeline for d6raia2:

• d6raia2 first appeared in SCOPe 2.07