SCOPe 2.08: Domain d6puxb1: 6pux B:10-372

Lineage for d6puxb1 (6pux B:10-372)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (131 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [189096] (13 PDB entries)

8. Domain d6puxb1: 6pux B:10-372 [372416]
   Other proteins in same PDB: d6puxa2, d6puxb2
   automated match to d3vvmb_
   complexed with cl, gol, mg, so4

Details for d6puxb1

PDB Entry: 6pux, 1.9 Å

PDB Description: homoserine transacetylase metx from mycobacterium tuberculosis

PDB Compounds: (B:) Homoserine O-acetyltransferase

SCOPe Domain Sequences for d6puxb1:

Sequence; same for both SEQRES and ATOM records:

>d6puxb1 c.69.1.0 (B:10-372) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
tlpaegeiglidvgslqlesgaviddvciavqrwgklspardnvvvvlhaltgdshitgp
agpghptpgwwdgvagpgapidttrwcavatnvlggcrgstgpsslardgkpwgsrfpli
sirdqvqadvaalaalgitevaavvggsmggaralewvvgypdrvraglllavgaratad
qigtqttqiaaikadpdwqsgdyhetgrapdaglrlarrfahltyrgeieldtrfanhnq
gnedptaggryavqsylehqgdkllsrfdagsyviltealnshdvgrgrggvsaalracp
vpvvvggitsdrlyplrlqqeladllpgcaglrvvesvyghdgflveteavgelirqtlg
lad

Timeline for d6puxb1:

• d6puxb1 first appeared in SCOPe 2.07