Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (131 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [189096] (13 PDB entries) |
Domain d6puxb1: 6pux B:10-372 [372416] Other proteins in same PDB: d6puxa2, d6puxb2 automated match to d3vvmb_ complexed with cl, gol, mg, so4 |
PDB Entry: 6pux (more details), 1.9 Å
SCOPe Domain Sequences for d6puxb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6puxb1 c.69.1.0 (B:10-372) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} tlpaegeiglidvgslqlesgaviddvciavqrwgklspardnvvvvlhaltgdshitgp agpghptpgwwdgvagpgapidttrwcavatnvlggcrgstgpsslardgkpwgsrfpli sirdqvqadvaalaalgitevaavvggsmggaralewvvgypdrvraglllavgaratad qigtqttqiaaikadpdwqsgdyhetgrapdaglrlarrfahltyrgeieldtrfanhnq gnedptaggryavqsylehqgdkllsrfdagsyviltealnshdvgrgrggvsaalracp vpvvvggitsdrlyplrlqqeladllpgcaglrvvesvyghdgflveteavgelirqtlg lad
Timeline for d6puxb1: