Lineage for d6g8ua_ (6g8u A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964873Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2964874Protein automated matches [190805] (20 species)
    not a true protein
  7. 2964881Species Clostridium botulinum [TaxId:1491] [193827] (10 PDB entries)
  8. 2964882Domain d6g8ua_: 6g8u A: [372277]
    automated match to d2etfa_
    complexed with zn

Details for d6g8ua_

PDB Entry: 6g8u (more details), 1.31 Å

PDB Description: crystal structure of the light chain of botulinum neurotoxin x (residues 2-427)
PDB Compounds: (A:) Light chain of botulinum neurotoxin X (res. 2-427)

SCOPe Domain Sequences for d6g8ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6g8ua_ d.92.1.0 (A:) automated matches {Clostridium botulinum [TaxId: 1491]}
kleinkfnyndpidginvitmrpprhsdkinkgkgpfkafqvikniwivperynftnntn
dlnipsepimeadaiynpnylntpsekdeflqgvikvlerikskpegekllelisssipl
plvsngaltlsdnetiayqennnivsnlqanlviygpgpdiannatyglystpisngegt
lsevsfspfylkpfdesygnyrslvnivnkfvkrefapdpastlmhelvhvthnlygisn
rnfyynfdtgkietsrqqnslifeelltfggidskaissliikkiietaknnyttliser
lntvtvendllkyiknkipvqgrlgnfkldtaefekklntilfvlnesnlaqrfsilvrk
hylkerpidpiyvnilddnsystlegfnissqgsndfqgqllessyfekiesn

SCOPe Domain Coordinates for d6g8ua_:

Click to download the PDB-style file with coordinates for d6g8ua_.
(The format of our PDB-style files is described here.)

Timeline for d6g8ua_: