Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) |
Family d.92.1.0: automated matches [191495] (1 protein) not a true family |
Protein automated matches [190805] (20 species) not a true protein |
Species Clostridium botulinum [TaxId:1491] [193827] (10 PDB entries) |
Domain d6g8ua_: 6g8u A: [372277] automated match to d2etfa_ complexed with zn |
PDB Entry: 6g8u (more details), 1.31 Å
SCOPe Domain Sequences for d6g8ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6g8ua_ d.92.1.0 (A:) automated matches {Clostridium botulinum [TaxId: 1491]} kleinkfnyndpidginvitmrpprhsdkinkgkgpfkafqvikniwivperynftnntn dlnipsepimeadaiynpnylntpsekdeflqgvikvlerikskpegekllelisssipl plvsngaltlsdnetiayqennnivsnlqanlviygpgpdiannatyglystpisngegt lsevsfspfylkpfdesygnyrslvnivnkfvkrefapdpastlmhelvhvthnlygisn rnfyynfdtgkietsrqqnslifeelltfggidskaissliikkiietaknnyttliser lntvtvendllkyiknkipvqgrlgnfkldtaefekklntilfvlnesnlaqrfsilvrk hylkerpidpiyvnilddnsystlegfnissqgsndfqgqllessyfekiesn
Timeline for d6g8ua_: