![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein Ubiquitin [54238] (9 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54239] (296 PDB entries) Uniprot P62988 identical sequence in many other species |
![]() | Domain d6qk9e1: 6qk9 E:1-74 [372121] Other proteins in same PDB: d6qk9a2, d6qk9b2, d6qk9c2, d6qk9e2, d6qk9f2, d6qk9h2, d6qk9i2, d6qk9j2, d6qk9k2, d6qk9l2 automated match to d5ibkc_ |
PDB Entry: 6qk9 (more details), 2.23 Å
SCOPe Domain Sequences for d6qk9e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6qk9e1 d.15.1.1 (E:1-74) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} mqifvktltvktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn iqkestlhlvlrlr
Timeline for d6qk9e1: