SCOPe 2.07: Domain d6q3se1: 6q3s E:2-113

Lineage for d6q3se1 (6q3s E:2-113)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)
   sequences may differ within each classified species

7. Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (30 PDB entries)

8. Domain d6q3se1: 6q3s E:2-113 [372114]
   Other proteins in same PDB: d6q3sa1, d6q3sa2, d6q3sb1, d6q3sb2, d6q3sd1, d6q3sd2, d6q3se2
   automated match to d2bnqe1
   complexed with act, gol

Details for d6q3se1

PDB Entry: 6q3s, 2.5 Å

PDB Description: engineered human hla_a2 mhc class i molecule in complex with tcr and sv9 peptide

PDB Compounds: (E:) T cell receptor beta variable 6-5,Human nkt tcr beta chain

SCOPe Domain Sequences for d6q3se1:

Sequence; same for both SEQRES and ATOM records:

>d6q3se1 b.1.1.1 (E:2-113) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
gvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgevpn
gynvsrsttedfplrllsaapsqtsvyfcassyvgntgelffgegsrltvle

Timeline for d6q3se1:

• d6q3se1 is new in SCOPe 2.07-stable
  
• d6q3se1 appears in the current release, SCOPe 2.08