Lineage for d6q3sa2 (6q3s A:182-274)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2368302Domain d6q3sa2: 6q3s A:182-274 [372061]
    Other proteins in same PDB: d6q3sa1, d6q3sb1, d6q3sb2, d6q3sd1, d6q3sd2, d6q3se1, d6q3se2
    automated match to d1ogaa1
    complexed with act, gol

Details for d6q3sa2

PDB Entry: 6q3s (more details), 2.5 Å

PDB Description: engineered human hla_a2 mhc class i molecule in complex with tcr and sv9 peptide
PDB Compounds: (A:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d6q3sa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6q3sa2 b.1.1.0 (A:182-274) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrw

SCOPe Domain Coordinates for d6q3sa2:

Click to download the PDB-style file with coordinates for d6q3sa2.
(The format of our PDB-style files is described here.)

Timeline for d6q3sa2: