Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d6ol7h_: 6ol7 H: [372049] Other proteins in same PDB: d6ol7a_, d6ol7b2, d6ol7c2, d6ol7e_, d6ol7f2, d6ol7k_, d6ol7l2, d6ol7n2, d6ol7p_ automated match to d2d7th_ complexed with cl, edo, peg |
PDB Entry: 6ol7 (more details), 2.42 Å
SCOPe Domain Sequences for d6ol7h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ol7h_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qvqlvqsgaevkkpgasvkvsckasgytftgyymhwvrqapgqglewmgwinpnsggtny aqkfqgrvtmtrdtsistaymelsrlrsddtavyycargknsdynwdfqhwgqgtlvtvg
Timeline for d6ol7h_: