Lineage for d6ol7b1 (6ol7 B:1-106)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2757562Domain d6ol7b1: 6ol7 B:1-106 [372029]
    Other proteins in same PDB: d6ol7a_, d6ol7b2, d6ol7c2, d6ol7e_, d6ol7f2, d6ol7k_, d6ol7l2, d6ol7n2, d6ol7p_
    automated match to d4v1db_
    complexed with cl, edo, peg

Details for d6ol7b1

PDB Entry: 6ol7 (more details), 2.42 Å

PDB Description: crystal structure of glvrc01 scfv in complex with anti-idiotype iv8 scfv
PDB Compounds: (B:) glVRC01 Light Chain

SCOPe Domain Sequences for d6ol7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ol7b1 b.1.1.0 (B:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
rfsgsgsgtdftltisslepedfavyycqqyeffgqgtklei

SCOPe Domain Coordinates for d6ol7b1:

Click to download the PDB-style file with coordinates for d6ol7b1.
(The format of our PDB-style files is described here.)

Timeline for d6ol7b1: