Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [186842] (212 PDB entries) |
Domain d6ol7k_: 6ol7 K: [372024] Other proteins in same PDB: d6ol7b1, d6ol7b2, d6ol7c_, d6ol7d_, d6ol7f1, d6ol7f2, d6ol7h_, d6ol7i_, d6ol7j_, d6ol7l1, d6ol7l2, d6ol7m_, d6ol7n1, d6ol7n2, d6ol7o_, d6ol7q_ automated match to d3ab0b_ complexed with cl, edo, peg |
PDB Entry: 6ol7 (more details), 2.42 Å
SCOPe Domain Sequences for d6ol7k_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ol7k_ b.1.1.1 (K:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} evklvesggdfvkpggslklscaasgftfsnsamswvrqtpekrlewvatinnnggythy pdtlkdrftisrdnvkntlylqmsslrsedtalyyctrqtywyldvwgagttvtvss
Timeline for d6ol7k_: