SCOPe 2.08: Domain d6ol7q_: 6ol7 Q:

Lineage for d6ol7q_ (6ol7 Q:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d6ol7q_: 6ol7 Q: [372005]
   Other proteins in same PDB: d6ol7a_, d6ol7b2, d6ol7c2, d6ol7e_, d6ol7f2, d6ol7k_, d6ol7l2, d6ol7n2, d6ol7p_
   automated match to d5kvel_
   complexed with cl, edo, peg

Details for d6ol7q_

PDB Entry: 6ol7, 2.42 Å

PDB Description: crystal structure of glvrc01 scfv in complex with anti-idiotype iv8 scfv

PDB Compounds: (Q:) iv8 Light Chain

SCOPe Domain Sequences for d6ol7q_:

Sequence; same for both SEQRES and ATOM records:

>d6ol7q_ b.1.1.0 (Q:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvvmsqspssltvslgekvtmtckssqsllysgnqknylawyqqkpgqspklliywastr
esgvpdrftgsgsgtdftliissvkaedlavyycqqfyfypwtfgggtkleikgggg

Timeline for d6ol7q_:

• d6ol7q_ first appeared in SCOPe 2.07