Lineage for d6ol7n1 (6ol7 N:1-106)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2367960Domain d6ol7n1: 6ol7 N:1-106 [371999]
    Other proteins in same PDB: d6ol7a_, d6ol7b2, d6ol7e_, d6ol7f2, d6ol7k_, d6ol7l2, d6ol7n2, d6ol7p_
    automated match to d4v1db_
    complexed with cl, edo, peg

Details for d6ol7n1

PDB Entry: 6ol7 (more details), 2.42 Å

PDB Description: crystal structure of glvrc01 scfv in complex with anti-idiotype iv8 scfv
PDB Compounds: (N:) glVRC01 Light Chain

SCOPe Domain Sequences for d6ol7n1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ol7n1 b.1.1.0 (N:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
rfsgsgsgtdftltisslepedfavyycqqyeffgqgtklei

SCOPe Domain Coordinates for d6ol7n1:

Click to download the PDB-style file with coordinates for d6ol7n1.
(The format of our PDB-style files is described here.)

Timeline for d6ol7n1: