Lineage for d6j11e_ (6j11 E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760850Domain d6j11e_: 6j11 E: [371873]
    Other proteins in same PDB: d6j11a_, d6j11b_, d6j11c_, d6j11d_, d6j11f_, d6j11h1, d6j11h2
    automated match to d4kuce_
    complexed with nag

Details for d6j11e_

PDB Entry: 6j11 (more details), 3 Å

PDB Description: mers-cov spike n-terminal domain and 7d10 scfv complex
PDB Compounds: (E:) VL of 7D10

SCOPe Domain Sequences for d6j11e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6j11e_ b.1.1.0 (E:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqspasltvslgqratiscrasksvsasgynylhwyqqrpgqppklliylafnles
gvparfngsgsgtdftlnihpveeedaatyycqhsrdlpftfgsgtkleik

SCOPe Domain Coordinates for d6j11e_:

Click to download the PDB-style file with coordinates for d6j11e_.
(The format of our PDB-style files is described here.)

Timeline for d6j11e_: