Lineage for d6fg1l1 (6fg1 L:1-105)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (26 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1264 PDB entries)
  8. 3071804Domain d6fg1l1: 6fg1 L:1-105 [371866]
    Other proteins in same PDB: d6fg1d1, d6fg1d2, d6fg1l2
    automated match to d1dn0a1
    complexed with gol

Details for d6fg1l1

PDB Entry: 6fg1 (more details), 2.03 Å

PDB Description: crystal structure of fab of natalizumab in complex with fab of naa32.
PDB Compounds: (L:) light chain of fab natalizumab

SCOPe Domain Sequences for d6fg1l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fg1l1 b.1.1.0 (L:1-105) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcktsqdinkymawyqqtpgkaprllihytsalqpgips
rfsgsgsgrdytftisslqpediatyyclqydnlwtfgqgtkvei

SCOPe Domain Coordinates for d6fg1l1:

Click to download the PDB-style file with coordinates for d6fg1l1.
(The format of our PDB-style files is described here.)

Timeline for d6fg1l1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6fg1l2