SCOPe 2.07: Domain d6s2la1: 6s2l A:1-470

Lineage for d6s2la1 (6s2l A:1-470)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.0: automated matches [227142] (1 protein)
   not a true family

6. Protein automated matches [226844] (11 species)
   not a true protein

7. Species Foot-and-mouth disease virus (isolate -/spain/s8c1santapau/1970 serotype c) [TaxId:12120] [371629] (1 PDB entry)

8. Domain d6s2la1: 6s2l A:1-470 [371630]
   Other proteins in same PDB: d6s2la2
   automated match to d5xe0a_
   complexed with gol

Details for d6s2la1

PDB Entry: 6s2l, 2.3 Å

PDB Description: fmdv 3d polymerase crystallized in presence of (f)uridylylated vpg peptide

PDB Compounds: (A:) Genome polyprotein

SCOPe Domain Sequences for d6s2la1:

Sequence; same for both SEQRES and ATOM records:

>d6s2la1 e.8.1.0 (A:1-470) automated matches {Foot-and-mouth disease virus (isolate -/spain/s8c1santapau/1970 serotype c) [TaxId: 12120]}
glivdtrdveervhvmrktklaptvahgvfnpefgpaalsnkdprlnegvvldevifskh
kgdtkmsaedkalfrrcaadyasrlhsvlgtanaplsiyeaikgvdgldamepdtapglp
walqgkrrgalidfengtvgpeveaalklmekreykfacqtflkdeirpmekvragktri
vdvlpvehilytrmmigrfcaqmhsnngpqigsavgcnpdvdwqrfgthfaqyrnvwdvd
ysafdanhcsdamnimfeevfrtefgfhpnaewilktlvntehayenkritveggmpsgc
satsiintilnniyvlyalrrhyegveldtytmisygddivvasdydldfealkphfksl
gqtitpadksdkgfvlghsitdvtflkrhfhmdygtgfykpvmasktleailsfarrgti
qeklisvaglavhsgpdeyrrlfepfqglfeipsyrslylrwvnavcgda

Timeline for d6s2la1:

• d6s2la1 is new in SCOPe 2.07-stable
  
• d6s2la1 appears in the current release, SCOPe 2.08