Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.0: automated matches [227142] (1 protein) not a true family |
Protein automated matches [226844] (11 species) not a true protein |
Species Foot-and-mouth disease virus (isolate -/spain/s8c1santapau/1970 serotype c) [TaxId:12120] [371629] (1 PDB entry) |
Domain d6s2la1: 6s2l A:1-470 [371630] Other proteins in same PDB: d6s2la2 automated match to d5xe0a_ complexed with gol |
PDB Entry: 6s2l (more details), 2.3 Å
SCOPe Domain Sequences for d6s2la1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6s2la1 e.8.1.0 (A:1-470) automated matches {Foot-and-mouth disease virus (isolate -/spain/s8c1santapau/1970 serotype c) [TaxId: 12120]} glivdtrdveervhvmrktklaptvahgvfnpefgpaalsnkdprlnegvvldevifskh kgdtkmsaedkalfrrcaadyasrlhsvlgtanaplsiyeaikgvdgldamepdtapglp walqgkrrgalidfengtvgpeveaalklmekreykfacqtflkdeirpmekvragktri vdvlpvehilytrmmigrfcaqmhsnngpqigsavgcnpdvdwqrfgthfaqyrnvwdvd ysafdanhcsdamnimfeevfrtefgfhpnaewilktlvntehayenkritveggmpsgc satsiintilnniyvlyalrrhyegveldtytmisygddivvasdydldfealkphfksl gqtitpadksdkgfvlghsitdvtflkrhfhmdygtgfykpvmasktleailsfarrgti qeklisvaglavhsgpdeyrrlfepfqglfeipsyrslylrwvnavcgda
Timeline for d6s2la1: