Lineage for d6s2la1 (6s2l A:1-470)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3016464Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 3016465Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 3018263Family e.8.1.0: automated matches [227142] (1 protein)
    not a true family
  6. 3018264Protein automated matches [226844] (11 species)
    not a true protein
  7. 3018267Species Foot-and-mouth disease virus (isolate -/spain/s8c1santapau/1970 serotype c) [TaxId:12120] [371629] (1 PDB entry)
  8. 3018268Domain d6s2la1: 6s2l A:1-470 [371630]
    Other proteins in same PDB: d6s2la2
    automated match to d5xe0a_
    complexed with gol

Details for d6s2la1

PDB Entry: 6s2l (more details), 2.3 Å

PDB Description: fmdv 3d polymerase crystallized in presence of (f)uridylylated vpg peptide
PDB Compounds: (A:) Genome polyprotein

SCOPe Domain Sequences for d6s2la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6s2la1 e.8.1.0 (A:1-470) automated matches {Foot-and-mouth disease virus (isolate -/spain/s8c1santapau/1970 serotype c) [TaxId: 12120]}
glivdtrdveervhvmrktklaptvahgvfnpefgpaalsnkdprlnegvvldevifskh
kgdtkmsaedkalfrrcaadyasrlhsvlgtanaplsiyeaikgvdgldamepdtapglp
walqgkrrgalidfengtvgpeveaalklmekreykfacqtflkdeirpmekvragktri
vdvlpvehilytrmmigrfcaqmhsnngpqigsavgcnpdvdwqrfgthfaqyrnvwdvd
ysafdanhcsdamnimfeevfrtefgfhpnaewilktlvntehayenkritveggmpsgc
satsiintilnniyvlyalrrhyegveldtytmisygddivvasdydldfealkphfksl
gqtitpadksdkgfvlghsitdvtflkrhfhmdygtgfykpvmasktleailsfarrgti
qeklisvaglavhsgpdeyrrlfepfqglfeipsyrslylrwvnavcgda

SCOPe Domain Coordinates for d6s2la1:

Click to download the PDB-style file with coordinates for d6s2la1.
(The format of our PDB-style files is described here.)

Timeline for d6s2la1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6s2la2