Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (160 species) not a true protein |
Species Chromobacterium violaceum [TaxId:243365] [371613] (1 PDB entry) |
Domain d6s4gd_: 6s4g D: [371620] automated match to d4ah3a_ complexed with edo, peg, pmp |
PDB Entry: 6s4g (more details), 1.67 Å
SCOPe Domain Sequences for d6s4gd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6s4gd_ c.67.1.0 (D:) automated matches {Chromobacterium violaceum [TaxId: 243365]} rttsqwreldaahhlhpftdtaslnqagarvmtrgegvylwdsegnkiidgmaglwcvnv gygrkdfaeaarrqmeelpfyntffktthpavvelssllaevtpagfdrvfytnsgsesv dtmirmvrrywdvqgkpekktligrwngyhgstiggaslggmkymheqgdlpipgmahie qpwwykhgkdmtpdefgvvaarwleekileigadkvaafvgepiqgaggvivppatywpe iericrkydvllvadevicgfgrtgewfghqhfgfqpdlftaakglssgylpigavfvgk rvaegliaggdfnhgftysghpvcaavahanvaalrdegivqrvkddigpymqkrwretf srfehvddvrgvgmvqaftlvknkakrelfpdfgeigtlcrdiffrnnlimracgdhivs applvmtraevdemlavaercleefeqtlkargl
Timeline for d6s4gd_: