SCOPe 2.08: Domain d6rdbt3: 6rdb T:436-562

Lineage for d6rdbt3 (6rdb T:436-562)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families)

5. Family a.69.1.0: automated matches [254233] (1 protein)
   not a true family

6. Protein automated matches [254528] (17 species)
   not a true protein

7. Species Polytomella sp. [TaxId:37502] [371492] (10 PDB entries)

8. Domain d6rdbt3: 6rdb T:436-562 [371521]
   Other proteins in same PDB: d6rdbs_, d6rdbt1, d6rdbt2
   automated match to d5cdfa3
   complexed with adp, atp, mg

Details for d6rdbt3

PDB Entry: 6rdb, 2.8 Å

PDB Description: cryoem structure of polytomella f-atp synthase, primary rotary state 1, focussed refinement of f1 head and rotor

PDB Compounds: (T:) ATP synthase subunit alpha

SCOPe Domain Sequences for d6rdbt3:

Sequence; same for both SEQRES and ATOM records:

>d6rdbt3 a.69.1.0 (T:436-562) automated matches {Polytomella sp. [TaxId: 37502]}
fpgmkqvagtlklelaqyrevaafaqfgsdldaatqyvlergarltemlkqkqfapipie
rqtvavyaatkgfldkvrvqdivaaeeavisqvnpavfkilkangkitpaldahlkaelr
kvklpga

Timeline for d6rdbt3:

• d6rdbt3 first appeared in SCOPe 2.07