SCOPe 2.08: Domain d6qh3b_: 6qh3 B:

Lineage for d6qh3b_ (6qh3 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein automated matches [190124] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186848] (52 PDB entries)

8. Domain d6qh3b_: 6qh3 B: [371383]
   automated match to d1zdna1
   complexed with edo

Details for d6qh3b_

PDB Entry: 6qh3, 2.9 Å

PDB Description: catalytic domain of the human ubiquitin-conjugating enzyme ube2s c118m

PDB Compounds: (B:) Ubiquitin-conjugating enzyme E2 S

SCOPe Domain Sequences for d6qh3b_:

Sequence; same for both SEQRES and ATOM records:

>d6qh3b_ d.20.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
phiirlvykevttltadppdgikvfpneedltdlqvtiegpegtpyagglfrmklllgkd
fpasppkgyfltkifhpnvgangeicvnvlkrdwtaelgirhvlltikmllihpnpesal
neeagrlllenyeeyaararllteihg

Timeline for d6qh3b_:

• d6qh3b_ first appeared in SCOPe 2.07