SCOPe 2.08: Domain d6qksa1: 6qks A:1-301

Lineage for d6qksa1 (6qks A:1-301)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (131 species)
   not a true protein

7. Species Rhodopseudomonas palustris [TaxId:258594] [329218] (38 PDB entries)

8. Domain d6qksa1: 6qks A:1-301 [371358]
   Other proteins in same PDB: d6qksa2
   automated match to d5k3ba_
   complexed with cl

Details for d6qksa1

PDB Entry: 6qks, 1.6 Å

PDB Description: crystal structure of the fluoroacetate dehalogenase rpa1163 - tyr219phe - apo

PDB Compounds: (A:) Fluoroacetate Dehalogenase

SCOPe Domain Sequences for d6qksa1:

Sequence; same for both SEQRES and ATOM records:

>d6qksa1 c.69.1.0 (A:1-301) automated matches {Rhodopseudomonas palustris [TaxId: 258594]}
mpdladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerfkv
ivadlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghdrgarvsyrla
ldspgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyvka
klaswtragdlsafdpravehyriafadpmrrhvmcedfragayadfehdkidveagnki
pvpmlalwgasgiaqsaatpldvwrkwasdvqgapiesghflpeeapdqtaealvrffsa
a

Timeline for d6qksa1:

• d6qksa1 first appeared in SCOPe 2.07