SCOP 1.73: Domain d1e2te_: 1e2t E:

Lineage for d1e2te_ (1e2t E:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (16 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.5: Arylamine N-acetyltransferase [54047] (1 protein)
   fold similar to that of the factor XIII catalytic domain

6. Protein Arylamine N-acetyltransferase [54048] (4 species)

7. Species Salmonella typhimurium [TaxId:90371] [54049] (1 PDB entry)

8. Domain d1e2te_: 1e2t E: [37125]

Details for d1e2te_

PDB Entry: 1e2t, 2.8 Å

PDB Description: arylamine n-acetyltransferase (nat) from salmonella typhimurium

PDB Compounds: (E:) n-hydroxyarylamine o-acetyltransferase

SCOP Domain Sequences for d1e2te_:

Sequence; same for both SEQRES and ATOM records:

>d1e2te_ d.3.1.5 (E:) Arylamine N-acetyltransferase {Salmonella typhimurium [TaxId: 602]}
hmtsflhayftrlhcqplgvptvealrtlhlahncaipfenldvllpreiqldetaleek
llyarrggycfelnglferalrdigfnvrsllgrvilshpaslpprthrlllvdvedeqw
iadvgfggqtltaplrlqaeiaqqtphgeyrlmqegstwilqfrhhehwqsmycfdlgvq
qqsdhvmgnfwsahwpqshfrhhllmcrhlpdggkltltnfhftryhqghaveqvnvpdv
pslyqllqqqfglgvndvkhgfteaelaavmaaf

Timeline for d1e2te_:

• d1e2te_ first appeared (with stable ids) in SCOP 1.55
  
• d1e2te_ appears in SCOP 1.71
  
• d1e2te_ appears in SCOP 1.75
  
• d1e2te_ appears in the current release, SCOPe 2.08