Lineage for d1e2te_ (1e2t E:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 29566Fold d.3: Cysteine proteinases [54000] (1 superfamily)
  4. 29567Superfamily d.3.1: Cysteine proteinases [54001] (7 families) (S)
  5. 29732Family d.3.1.5: Arylamine N-acetyltransferase [54047] (1 protein)
  6. 29733Protein Arylamine N-acetyltransferase [54048] (1 species)
  7. 29734Species Salmonella typhimurium [TaxId:90371] [54049] (1 PDB entry)
  8. 29739Domain d1e2te_: 1e2t E: [37125]

Details for d1e2te_

PDB Entry: 1e2t (more details), 2.8 Å

PDB Description: arylamine n-acetyltransferase (nat) from salmonella typhimurium

SCOP Domain Sequences for d1e2te_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e2te_ d.3.1.5 (E:) Arylamine N-acetyltransferase {Salmonella typhimurium}
hmtsflhayftrlhcqplgvptvealrtlhlahncaipfenldvllpreiqldetaleek
llyarrggycfelnglferalrdigfnvrsllgrvilshpaslpprthrlllvdvedeqw
iadvgfggqtltaplrlqaeiaqqtphgeyrlmqegstwilqfrhhehwqsmycfdlgvq
qqsdhvmgnfwsahwpqshfrhhllmcrhlpdggkltltnfhftryhqghaveqvnvpdv
pslyqllqqqfglgvndvkhgfteaelaavmaaf

SCOP Domain Coordinates for d1e2te_:

Click to download the PDB-style file with coordinates for d1e2te_.
(The format of our PDB-style files is described here.)

Timeline for d1e2te_: