![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (11 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.5: Arylamine N-acetyltransferase [54047] (1 protein) fold similar to that of the factor XIII catalytic domain |
![]() | Protein Arylamine N-acetyltransferase [54048] (2 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [54049] (1 PDB entry) |
![]() | Domain d1e2tb_: 1e2t B: [37122] |
PDB Entry: 1e2t (more details), 2.8 Å
SCOP Domain Sequences for d1e2tb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e2tb_ d.3.1.5 (B:) Arylamine N-acetyltransferase {Salmonella typhimurium} hmtsflhayftrlhcqplgvptvealrtlhlahncaipfenldvllpreiqldetaleek llyarrggycfelnglferalrdigfnvrsllgrvilshpaslpprthrlllvdvedeqw iadvgfggqtltaplrlqaeiaqqtphgeyrlmqegstwilqfrhhehwqsmycfdlgvq qqsdhvmgnfwsahwpqshfrhhllmcrhlpdggkltltnfhftryhqghaveqvnvpdv pslyqllqqqfglgvndvkhgfteaelaavmaaf
Timeline for d1e2tb_: