Lineage for d1e2ta_ (1e2t A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 498098Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 498099Superfamily d.3.1: Cysteine proteinases [54001] (11 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 498366Family d.3.1.5: Arylamine N-acetyltransferase [54047] (1 protein)
    fold similar to that of the factor XIII catalytic domain
  6. 498367Protein Arylamine N-acetyltransferase [54048] (2 species)
  7. 498373Species Salmonella typhimurium [TaxId:90371] [54049] (1 PDB entry)
  8. 498374Domain d1e2ta_: 1e2t A: [37121]

Details for d1e2ta_

PDB Entry: 1e2t (more details), 2.8 Å

PDB Description: arylamine n-acetyltransferase (nat) from salmonella typhimurium
PDB Compounds: (A:)

SCOP Domain Sequences for d1e2ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e2ta_ d.3.1.5 (A:) Arylamine N-acetyltransferase {Salmonella typhimurium}
hmtsflhayftrlhcqplgvptvealrtlhlahncaipfenldvllpreiqldetaleek
llyarrggycfelnglferalrdigfnvrsllgrvilshpaslpprthrlllvdvedeqw
iadvgfggqtltaplrlqaeiaqqtphgeyrlmqegstwilqfrhhehwqsmycfdlgvq
qqsdhvmgnfwsahwpqshfrhhllmcrhlpdggkltltnfhftryhqghaveqvnvpdv
pslyqllqqqfglgvndvkhgfteaelaavmaaf

SCOP Domain Coordinates for d1e2ta_:

Click to download the PDB-style file with coordinates for d1e2ta_.
(The format of our PDB-style files is described here.)

Timeline for d1e2ta_: