Class b: All beta proteins [48724] (180 folds) |
Fold b.77: beta-Prism I [51091] (4 superfamilies) consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis duplication: has internal pseudo threefold symmetry |
Superfamily b.77.2: delta-Endotoxin (insectocide), middle domain [51096] (2 families) |
Family b.77.2.0: automated matches [254290] (1 protein) not a true family |
Protein automated matches [254673] (3 species) not a true protein |
Species Bacillus thuringiensis [TaxId:1428] [255813] (7 PDB entries) |
Domain d6ovba2: 6ovb A:253-450 [371209] Other proteins in same PDB: d6ovba1, d6ovba3 automated match to d1dlca2 |
PDB Entry: 6ovb (more details), 2.61 Å
SCOPe Domain Sequences for d6ovba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ovba2 b.77.2.0 (A:253-450) automated matches {Bacillus thuringiensis [TaxId: 1428]} typiqtatqltrevyldlpfinenlspaavyptfsaaesaiirsphlvdflnsftiytds larsaywgghlvnsfrtgtttnlirsplygregnterpvtitaspsvpifrtlsyptgld nsnpvagiegvefqntisrsiyrksgpidsfselppqdasvspaigyshrlchatfleri sgpriagtvfswthrsas
Timeline for d6ovba2: