Lineage for d6ovba2 (6ovb A:253-450)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813105Fold b.77: beta-Prism I [51091] (4 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 2813112Superfamily b.77.2: delta-Endotoxin (insectocide), middle domain [51096] (2 families) (S)
  5. 2813125Family b.77.2.0: automated matches [254290] (1 protein)
    not a true family
  6. 2813126Protein automated matches [254673] (3 species)
    not a true protein
  7. 2813127Species Bacillus thuringiensis [TaxId:1428] [255813] (7 PDB entries)
  8. 2813138Domain d6ovba2: 6ovb A:253-450 [371209]
    Other proteins in same PDB: d6ovba1, d6ovba3
    automated match to d1dlca2

Details for d6ovba2

PDB Entry: 6ovb (more details), 2.61 Å

PDB Description: crystal structure of a bacillus thuringiensis cry1da tryptic core variant
PDB Compounds: (A:) Active core crystal toxin protein 1D

SCOPe Domain Sequences for d6ovba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ovba2 b.77.2.0 (A:253-450) automated matches {Bacillus thuringiensis [TaxId: 1428]}
typiqtatqltrevyldlpfinenlspaavyptfsaaesaiirsphlvdflnsftiytds
larsaywgghlvnsfrtgtttnlirsplygregnterpvtitaspsvpifrtlsyptgld
nsnpvagiegvefqntisrsiyrksgpidsfselppqdasvspaigyshrlchatfleri
sgpriagtvfswthrsas

SCOPe Domain Coordinates for d6ovba2:

Click to download the PDB-style file with coordinates for d6ovba2.
(The format of our PDB-style files is described here.)

Timeline for d6ovba2: