Lineage for d6owka3 (6owk A:494-640)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775002Species Bacillus thuringiensis [TaxId:1428] [255814] (7 PDB entries)
  8. 2775014Domain d6owka3: 6owk A:494-640 [371198]
    Other proteins in same PDB: d6owka1, d6owka2
    automated match to d1dlca1

Details for d6owka3

PDB Entry: 6owk (more details), 2.7 Å

PDB Description: crystal structure of a bacillus thuringiensis cry1b.867 tryptic core variant
PDB Compounds: (A:) Pesticidal crystal protein Cry1Be, Cry1K-like protein chimera

SCOPe Domain Sequences for d6owka3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6owka3 b.18.1.0 (A:494-640) automated matches {Bacillus thuringiensis [TaxId: 1428]}
rtntissdsitqiplvkahtlqsgttvvkgpgftggdilrrtsggpfafsnvnldfnlsq
ryrariryasttnlriyvtvagerifagqfdktmdagapltfqsfsyatintaftfpers
ssltvgadtfssgnevyvdrfelipvt

SCOPe Domain Coordinates for d6owka3:

Click to download the PDB-style file with coordinates for d6owka3.
(The format of our PDB-style files is described here.)

Timeline for d6owka3: