Class b: All beta proteins [48724] (180 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (51 species) not a true protein |
Species Bacillus thuringiensis [TaxId:1428] [255814] (7 PDB entries) |
Domain d6owka3: 6owk A:494-640 [371198] Other proteins in same PDB: d6owka1, d6owka2 automated match to d1dlca1 |
PDB Entry: 6owk (more details), 2.7 Å
SCOPe Domain Sequences for d6owka3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6owka3 b.18.1.0 (A:494-640) automated matches {Bacillus thuringiensis [TaxId: 1428]} rtntissdsitqiplvkahtlqsgttvvkgpgftggdilrrtsggpfafsnvnldfnlsq ryrariryasttnlriyvtvagerifagqfdktmdagapltfqsfsyatintaftfpers ssltvgadtfssgnevyvdrfelipvt
Timeline for d6owka3: