Lineage for d6o60d1 (6o60 D:2-67)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2513276Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2513277Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2513558Family d.42.1.0: automated matches [191460] (1 protein)
    not a true family
  6. 2513559Protein automated matches [190710] (4 species)
    not a true protein
  7. 2513560Species Human (Homo sapiens) [TaxId:9606] [187857] (47 PDB entries)
  8. 3071131Domain d6o60d1: 6o60 D:2-67 [371193]
    Other proteins in same PDB: d6o60b_, d6o60d2
    automated match to d5k35b1
    complexed with zn

Details for d6o60d1

PDB Entry: 6o60 (more details), 2.5 Å

PDB Description: crystal structure of ggtase3-fbxl2-skp1 complex
PDB Compounds: (D:) S-phase kinase-associated protein 1

SCOPe Domain Sequences for d6o60d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6o60d1 d.42.1.0 (D:2-67) automated matches {Human (Homo sapiens) [TaxId: 9606]}
psiklqssdgeifevdveiakqsvtiktmledlgmddegdddpvplpnvnaailkkviqw
cthhkd

SCOPe Domain Coordinates for d6o60d1:

Click to download the PDB-style file with coordinates for d6o60d1.
(The format of our PDB-style files is described here.)

Timeline for d6o60d1:

  • d6o60d1 appears in periodic updates to SCOPe 2.07 starting on 2019-07-21

View in 3D
Domains from same chain:
(mouse over for more information)
d6o60d2
View in 3D
Domains from other chains:
(mouse over for more information)
d6o60b_