Lineage for d1ggyb4 (1ggy B:191-508)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 29566Fold d.3: Cysteine proteinases [54000] (1 superfamily)
  4. 29567Superfamily d.3.1: Cysteine proteinases [54001] (7 families) (S)
  5. 29715Family d.3.1.4: Transglutaminase [54044] (1 protein)
  6. 29716Protein Coagulation factor XIII, catalytic domain [54045] (1 species)
  7. 29717Species Human (Homo sapiens), blood [TaxId:9606] [54046] (7 PDB entries)
  8. 29727Domain d1ggyb4: 1ggy B:191-508 [37118]
    Other proteins in same PDB: d1ggya1, d1ggya2, d1ggya3, d1ggyb1, d1ggyb2, d1ggyb3

Details for d1ggyb4

PDB Entry: 1ggy (more details), 2.5 Å

PDB Description: human factor xiii with ytterbium bound in the ion site

SCOP Domain Sequences for d1ggyb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ggyb4 d.3.1.4 (B:191-508) Coagulation factor XIII, catalytic domain {Human (Homo sapiens), blood}
davyldnekereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmdls
grgnpikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssenpvr
ygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkdsvw
nyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfdapf
vfaevnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegqeee
rlaletalmygakkplnt

SCOP Domain Coordinates for d1ggyb4:

Click to download the PDB-style file with coordinates for d1ggyb4.
(The format of our PDB-style files is described here.)

Timeline for d1ggyb4: