Lineage for d6ogxl2 (6ogx L:107-210)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751402Domain d6ogxl2: 6ogx L:107-210 [371143]
    Other proteins in same PDB: d6ogxc_, d6ogxd1, d6ogxg1, d6ogxg2, d6ogxg3, d6ogxh_, d6ogxl1
    automated match to d1dn0a2
    complexed with nag

Details for d6ogxl2

PDB Entry: 6ogx (more details), 2.77 Å

PDB Description: ternary complex of ox40r (tnfrsf4) bound to fab1 and fab2
PDB Compounds: (L:) FAb2 Light Chain

SCOPe Domain Sequences for d6ogxl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ogxl2 b.1.1.2 (L:107-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfn

SCOPe Domain Coordinates for d6ogxl2:

Click to download the PDB-style file with coordinates for d6ogxl2.
(The format of our PDB-style files is described here.)

Timeline for d6ogxl2: