Lineage for d6ojub1 (6oju B:30-313)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2972108Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2972109Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2972110Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2972208Protein Thymidylate synthase [55833] (7 species)
  7. 2972355Species Human (Homo sapiens) [TaxId:9606] [55840] (47 PDB entries)
  8. 2972489Domain d6ojub1: 6oju B:30-313 [371138]
    Other proteins in same PDB: d6ojua2, d6ojub2, d6ojuc2, d6ojud2
    automated match to d1hzwa_
    complexed with d96, ump

Details for d6ojub1

PDB Entry: 6oju (more details), 2.88 Å

PDB Description: crystal structure of human thymidylate synthase delta (7-29) in complex with dump and 2-amino-4-oxo-4,7-dihydro-pyrrolo[2,3- d]pyrimidine-methyl-phenyl-d-glutamic acid
PDB Compounds: (B:) Thymidylate synthase,Thymidylate synthase

SCOPe Domain Sequences for d6ojub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ojub1 d.117.1.1 (B:30-313) Thymidylate synthase {Human (Homo sapiens) [TaxId: 9606]}
elqylgqiqhilrcgvrkddrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvleell
wfikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfgaeyrdm
esdysgqgvdqlqrvidtiktnpddrriimcawnprdlplmalppchalcqfyvvnsels
cqlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhieplkiql
qreprpfpklrilrkvekiddfkaedfqiegynphptikmemav

SCOPe Domain Coordinates for d6ojub1:

Click to download the PDB-style file with coordinates for d6ojub1.
(The format of our PDB-style files is described here.)

Timeline for d6ojub1:

  • d6ojub1 first appeared in SCOPe 2.07, called d6ojub_