![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein Ubiquitin [54238] (9 species) |
![]() | Species Schizosaccharomyces pombe [TaxId:284812] [371037] (2 PDB entries) |
![]() | Domain d6o82b_: 6o82 B: [371132] automated match to d3cmmb_ complexed with edo, jzu, mg, pop, so4 |
PDB Entry: 6o82 (more details), 2.6 Å
SCOPe Domain Sequences for d6o82b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6o82b_ d.15.1.1 (B:) Ubiquitin {Schizosaccharomyces pombe [TaxId: 284812]} mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn iqkestlhlvlrlcgg
Timeline for d6o82b_: