Lineage for d6o83b_ (6o83 B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2501112Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2501389Protein Ubiquitin [54238] (9 species)
  7. 3070975Species Schizosaccharomyces pombe [TaxId:284812] [371037] (2 PDB entries)
  8. 3071038Domain d6o83b_: 6o83 B: [371100]
    automated match to d3cmmb_
    complexed with ca, mpd, trs, vmx

Details for d6o83b_

PDB Entry: 6o83 (more details), 3.15 Å

PDB Description: s. pombe ubiquitin e1~ubiquitin-amp tetrahedral intermediate mimic
PDB Compounds: (B:) ubiquitin-60s ribosomal protein l40

SCOPe Domain Sequences for d6o83b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6o83b_ d.15.1.1 (B:) Ubiquitin {Schizosaccharomyces pombe [TaxId: 284812]}
mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
iqkestlhlvlrlrg

SCOPe Domain Coordinates for d6o83b_:

Click to download the PDB-style file with coordinates for d6o83b_.
(The format of our PDB-style files is described here.)

Timeline for d6o83b_:

  • d6o83b_ is new in SCOPe 2.07-stable