Lineage for d1fieb4 (1fie B:191-515)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 76916Fold d.3: Cysteine proteinases [54000] (1 superfamily)
  4. 76917Superfamily d.3.1: Cysteine proteinases [54001] (7 families) (S)
  5. 77069Family d.3.1.4: Transglutaminase catalytic domain [54044] (1 protein)
  6. 77070Protein Transglutaminase catalytic domain [54045] (2 species)
  7. 77071Species Human (Homo sapiens) [TaxId:9606] [54046] (7 PDB entries)
  8. 77079Domain d1fieb4: 1fie B:191-515 [37110]
    Other proteins in same PDB: d1fiea1, d1fiea2, d1fiea3, d1fieb1, d1fieb2, d1fieb3

Details for d1fieb4

PDB Entry: 1fie (more details), 2.5 Å

PDB Description: recombinant human coagulation factor xiii

SCOP Domain Sequences for d1fieb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fieb4 d.3.1.4 (B:191-515) Transglutaminase catalytic domain {Human (Homo sapiens)}
davyldnekereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmdls
grgnpikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssenpvr
ygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkdsvw
nyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfdapf
vfaevnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegqeee
rlaletalmygakkplntegvmksr

SCOP Domain Coordinates for d1fieb4:

Click to download the PDB-style file with coordinates for d1fieb4.
(The format of our PDB-style files is described here.)

Timeline for d1fieb4: