Lineage for d6o60b_ (6o60 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330024Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2330425Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 2330553Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins)
  6. 2330670Protein Rab geranylgeranyltransferase, beta subunit [48249] (2 species)
  7. 3070984Species Homo sapiens [TaxId:9606] [371046] (1 PDB entry)
  8. 3070985Domain d6o60b_: 6o60 B: [371047]
    Other proteins in same PDB: d6o60d1, d6o60d2
    automated match to d1dceb_
    complexed with zn

Details for d6o60b_

PDB Entry: 6o60 (more details), 2.5 Å

PDB Description: crystal structure of ggtase3-fbxl2-skp1 complex
PDB Compounds: (B:) Geranylgeranyl transferase type-2 subunit beta

SCOPe Domain Sequences for d6o60b_:

Sequence, based on SEQRES records: (download)

>d6o60b_ a.102.4.3 (B:) Rab geranylgeranyltransferase, beta subunit {Homo sapiens [TaxId: 9606]}
kdviiksdapdtlllekhadyiasygskkddyeycmseylrmsgiywgltvmdlmgqlhr
mnreeilafikscqhecggisasighdphllytlsavqiltlydsinvidvnkvveyvkg
lqkedgsfagdiwgeidtrfsfcavatlallgkldainvekaiefvlscmnfdggfgcrp
gseshagqiycctgflaitsqlhqvnsdllgwwlcerqlpsgglngrpeklpdvcyswwv
laslkiigrlhwidreklrnfilacqdeetggfadrpgdmvdpfhtlfgiaglsllgeeq
ikpvnpvfcmpeevlqrvnvqpe

Sequence, based on observed residues (ATOM records): (download)

>d6o60b_ a.102.4.3 (B:) Rab geranylgeranyltransferase, beta subunit {Homo sapiens [TaxId: 9606]}
kdviiksdapdtlllekhadyiasygddyeycmseylrmsgiywgltvmdlmgqlhrmnr
eeilafikscqhecggisasighdphllytlsavqiltlydsinvidvnkvveyvkglqk
edgsfagdiwgeidtrfsfcavatlallgkldainvekaiefvlscmnfdggfgcrpgse
shagqiycctgflaitsqlhqvnsdllgwwlcerqlpsgglngrpeklpdvcyswwvlas
lkiigrlhwidreklrnfilacqdeetggfadrpgdmvdpfhtlfgiaglsllgeeqikp
vnpvfcmpeevlqrvnvqpe

SCOPe Domain Coordinates for d6o60b_:

Click to download the PDB-style file with coordinates for d6o60b_.
(The format of our PDB-style files is described here.)

Timeline for d6o60b_:

  • d6o60b_ appears in periodic updates to SCOPe 2.07 starting on 2019-07-21