Lineage for d6novb2 (6nov B:113-218)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (26 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1264 PDB entries)
  8. 3070905Domain d6novb2: 6nov B:113-218 [370967]
    Other proteins in same PDB: d6novb1, d6novd1
    automated match to d1t66c2
    complexed with 12p

Details for d6novb2

PDB Entry: 6nov (more details), 2.14 Å

PDB Description: a fab derived from ixekizumab
PDB Compounds: (B:) Fab light chain

SCOPe Domain Sequences for d6novb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6novb2 b.1.1.0 (B:113-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d6novb2:

Click to download the PDB-style file with coordinates for d6novb2.
(The format of our PDB-style files is described here.)

Timeline for d6novb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6novb1