SCOPe 2.08: Domain d6nhgd2: 6nhg D:196-241

Lineage for d6nhgd2 (6nhg D:196-241)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (2 families)

5. Family f.23.11.1: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81495] (1 protein)

6. Protein Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81494] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81491] (19 PDB entries)
   Uniprot P00125

8. Domain d6nhgd2: 6nhg D:196-241 [370830]
   Other proteins in same PDB: d6nhga1, d6nhga2, d6nhgb1, d6nhgb2, d6nhgc1, d6nhgc2, d6nhgd1, d6nhge1, d6nhge2, d6nhgg_, d6nhgh_, d6nhgj_, d6nhgk_
   automated match to d1ntmd2
   complexed with 6pe, 8pe, azo, cdl, fes, hec, hem, mc3

Details for d6nhgd2

PDB Entry: 6nhg, 2.8 Å

PDB Description: rhodobacter sphaeroides mitochondrial respiratory chain complex

PDB Compounds: (D:) Cytochrome c1, heme protein, mitochondrial

SCOPe Domain Sequences for d6nhgd2:

Sequence; same for both SEQRES and ATOM records:

>d6nhgd2 f.23.11.1 (D:196-241) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Cow (Bos taurus) [TaxId: 9913]}
pehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrppk

Timeline for d6nhgd2:

• d6nhgd2 first appeared in SCOPe 2.07