SCOPe 2.08: Domain d7pcka_: 7pck A:

Lineage for d7pcka_ (7pck A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein (Pro)cathepsin K [54028] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54029] (56 PDB entries)
   Uniprot P43235 116-329 ! Uniprot P43235 115-329

8. Domain d7pcka_: 7pck A: [37079]
   contains propeptide
   has additional insertions and/or extensions that are not grouped together

Details for d7pcka_

PDB Entry: 7pck, 3.2 Å

PDB Description: crystal structure of wild type human procathepsin k

PDB Compounds: (A:) protein (procathepsin k)

SCOPe Domain Sequences for d7pcka_:

Sequence; same for both SEQRES and ATOM records:

>d7pcka_ d.3.1.1 (A:) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]}
lypeeildthwelwkkthrkqynnkvdeisrrliweknlkyisihnleaslgvhtyelam
nhlgdmtseevvqkmtglkvplshsrsndtlyipewegrapdsvdyrkkgyvtpvknqgq
cgscwafssvgalegqlkkktgkllnlspqnlvdcvsendgcgggymtnafqyvqknrgi
dsedaypyvgqeescmynptgkaakcrgyreipegnekalkravarvgpvsvaidaslts
fqfyskgvyydescnsdnlnhavlavgygiqkgnkhwiiknswgenwgnkgyilmarnkn
nacgianlasfpkm

Timeline for d7pcka_:

• d7pcka_ first appeared (with stable ids) in SCOP 1.55
  
• d7pcka_ appears in SCOPe 2.07