SCOPe 2.08: Domain d6nnha_: 6nnh A:

Lineage for d6nnha_ (6nnh A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein Dihydrofolate reductase, prokaryotic type [53599] (9 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [53602] (24 PDB entries)

8. Domain d6nnha_: 6nnh A: [370781]
   automated match to d1df7a_
   complexed with 1cy, co, gol, ndp, so4

Details for d6nnha_

PDB Entry: 6nnh, 1.52 Å

PDB Description: structure of closed state of dihydrofolate reductase from mycobacterium tuberculosis in complex with nadph and cycloguanil

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d6nnha_:

Sequence; same for both SEQRES and ATOM records:

>d6nnha_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Mycobacterium tuberculosis [TaxId: 1773]}
mvgliwaqatsgvigrggdipwrlpedqahfreitmghtivmgrrtwdslpakvrplpgr
rnvvlsrqadfmasgaevvgsleealtspetwvigggqvyalalpyatrcevtevdiglp
reagdalapvldetwrgetgewrfsrsglryrlysyhrs

Timeline for d6nnha_:

• d6nnha_ first appeared in SCOPe 2.07