SCOPe 2.08: Domain d6nhgc2: 6nhg C:261-379

Lineage for d6nhgc2 (6nhg C:261-379)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
   core: three transmembrane helices, up-and-down bundle

4. Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families)

5. Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (3 proteins)
   a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria

6. Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81643] (19 PDB entries)
   Uniprot P00157

8. Domain d6nhgc2: 6nhg C:261-379 [370768]
   Other proteins in same PDB: d6nhga1, d6nhga2, d6nhgb1, d6nhgb2, d6nhgc1, d6nhgd1, d6nhgd2, d6nhge1, d6nhge2, d6nhgg_, d6nhgh_, d6nhgj_, d6nhgk_
   automated match to d1ntmc1
   complexed with 6pe, 8pe, azo, cdl, fes, hec, hem, mc3

Details for d6nhgc2

PDB Entry: 6nhg, 2.8 Å

PDB Description: rhodobacter sphaeroides mitochondrial respiratory chain complex

PDB Compounds: (C:) cytochrome b

SCOPe Domain Sequences for d6nhgc2:

Sequence; same for both SEQRES and ATOM records:

>d6nhgc2 f.32.1.1 (C:261-379) Mitochondrial cytochrome b subunit, C-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
plntpphikpewyflfayailrsipnklggvlalafsililalipllhtskqrsmmfrpl
sqclfwalvadlltltwiggqpvehpyitigqlasvlyfllilvlmptagtienkllkw

Timeline for d6nhgc2:

• d6nhgc2 first appeared in SCOPe 2.07