![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily) core: three transmembrane helices, up-and-down bundle |
![]() | Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) ![]() |
![]() | Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (3 proteins) a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
![]() | Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81643] (19 PDB entries) Uniprot P00157 |
![]() | Domain d6nhgc2: 6nhg C:261-379 [370768] Other proteins in same PDB: d6nhga1, d6nhga2, d6nhgb1, d6nhgb2, d6nhgc1, d6nhgd1, d6nhgd2, d6nhge1, d6nhge2, d6nhgg_, d6nhgh_, d6nhgj_, d6nhgk_ automated match to d1ntmc1 complexed with 6pe, 8pe, azo, cdl, fes, hec, hem, mc3 |
PDB Entry: 6nhg (more details), 2.8 Å
SCOPe Domain Sequences for d6nhgc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6nhgc2 f.32.1.1 (C:261-379) Mitochondrial cytochrome b subunit, C-terminal domain {Cow (Bos taurus) [TaxId: 9913]} plntpphikpewyflfayailrsipnklggvlalafsililalipllhtskqrsmmfrpl sqclfwalvadlltltwiggqpvehpyitigqlasvlyfllilvlmptagtienkllkw
Timeline for d6nhgc2: