![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family) ![]() automatically mapped to Pfam PF02939 |
![]() | Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (2 proteins) |
![]() | Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species) together with cytochrome b binds to ubiquinone |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81503] (21 PDB entries) Uniprot P13271 #SP ! Uniprot P13271 |
![]() | Domain d6nhgg_: 6nhg G: [370766] Other proteins in same PDB: d6nhga1, d6nhga2, d6nhgb1, d6nhgb2, d6nhgc1, d6nhgc2, d6nhgd1, d6nhgd2, d6nhge1, d6nhge2, d6nhgh_, d6nhgj_, d6nhgk_ automated match to d1be3g_ complexed with 6pe, 8pe, azo, cdl, fes, hec, hem, mc3 |
PDB Entry: 6nhg (more details), 2.8 Å
SCOPe Domain Sequences for d6nhgg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6nhgg_ f.23.13.1 (G:) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]} grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt wgtqefekskrknpa
Timeline for d6nhgg_: