Lineage for d6nhgg_ (6nhg G:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631316Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family) (S)
    automatically mapped to Pfam PF02939
  5. 2631317Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (2 proteins)
  6. 2631318Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species)
    together with cytochrome b binds to ubiquinone
  7. 2631338Species Cow (Bos taurus) [TaxId:9913] [81503] (21 PDB entries)
    Uniprot P13271 #SP ! Uniprot P13271
  8. 2631356Domain d6nhgg_: 6nhg G: [370766]
    Other proteins in same PDB: d6nhga1, d6nhga2, d6nhgb1, d6nhgb2, d6nhgc1, d6nhgc2, d6nhgd1, d6nhgd2, d6nhge1, d6nhge2, d6nhgh_, d6nhgj_, d6nhgk_
    automated match to d1be3g_
    complexed with 6pe, 8pe, azo, cdl, fes, hec, hem, mc3

Details for d6nhgg_

PDB Entry: 6nhg (more details), 2.8 Å

PDB Description: rhodobacter sphaeroides mitochondrial respiratory chain complex
PDB Compounds: (G:) Cytochrome b-c1 complex subunit 8

SCOPe Domain Sequences for d6nhgg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nhgg_ f.23.13.1 (G:) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
wgtqefekskrknpa

SCOPe Domain Coordinates for d6nhgg_:

Click to download the PDB-style file with coordinates for d6nhgg_.
(The format of our PDB-style files is described here.)

Timeline for d6nhgg_: