Lineage for d6nhgk_ (6nhg K:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631452Superfamily f.23.15: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81518] (1 family) (S)
    automatically mapped to Pfam PF08997
  5. 2631453Family f.23.15.1: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81517] (2 proteins)
  6. 2631469Protein automated matches [190648] (1 species)
    not a true protein
  7. 2631470Species Cow (Bos taurus) [TaxId:9913] [187726] (5 PDB entries)
  8. 2631475Domain d6nhgk_: 6nhg K: [370759]
    Other proteins in same PDB: d6nhga1, d6nhga2, d6nhgb1, d6nhgb2, d6nhgc1, d6nhgc2, d6nhgd1, d6nhgd2, d6nhge1, d6nhge2, d6nhgg_, d6nhgh_, d6nhgj_
    automated match to d1sqqk1
    complexed with 6pe, 8pe, azo, cdl, fes, hec, hem, mc3

Details for d6nhgk_

PDB Entry: 6nhg (more details), 2.8 Å

PDB Description: rhodobacter sphaeroides mitochondrial respiratory chain complex
PDB Compounds: (K:) cytochrome b-c1 complex subunit 10

SCOPe Domain Sequences for d6nhgk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nhgk_ f.23.15.1 (K:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ltrflgpryrqlarnwvptaslwgavgavglvwatdwrlildwvpyingkfk

SCOPe Domain Coordinates for d6nhgk_:

Click to download the PDB-style file with coordinates for d6nhgk_.
(The format of our PDB-style files is described here.)

Timeline for d6nhgk_: