Lineage for d6nhgb1 (6nhg B:15-235)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2562006Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 2562007Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 2562008Family d.185.1.1: MPP-like [63412] (7 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 2562083Protein Cytochrome bc1 core subunit 2 [63409] (4 species)
  7. 2562112Species Cow (Bos taurus) [TaxId:9913] [56000] (19 PDB entries)
    Uniprot P23004
  8. 3070694Domain d6nhgb1: 6nhg B:15-235 [370756]
    Other proteins in same PDB: d6nhga1, d6nhga2, d6nhgc1, d6nhgc2, d6nhgd1, d6nhgd2, d6nhge1, d6nhge2, d6nhgg_, d6nhgh_, d6nhgj_, d6nhgk_
    automated match to d1ntmb1
    complexed with 6pe, 8pe, azo, cdl, fes, hec, hem, mc3

Details for d6nhgb1

PDB Entry: 6nhg (more details), 2.8 Å

PDB Description: rhodobacter sphaeroides mitochondrial respiratory chain complex
PDB Compounds: (B:) Cytochrome b-c1 complex subunit 2, mitochondrial

SCOPe Domain Sequences for d6nhgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nhgb1 d.185.1.1 (B:15-235) Cytochrome bc1 core subunit 2 {Cow (Bos taurus) [TaxId: 9913]}
agvpphpqdleftrlpnglviaslenyapasriglfikagsryensnnlgtshllrlass
lttkgassfkitrgieavggklsvtstrenmaytveclrddvdilmefllnvttapefrr
wevaalqpqlridkavalqnpqahvienlhaaayrnalanslycpdyrigkvtpvelhdy
vqnhftsarmaliglgvshpvlkqvaeqflnirgglglsga

SCOPe Domain Coordinates for d6nhgb1:

Click to download the PDB-style file with coordinates for d6nhgb1.
(The format of our PDB-style files is described here.)

Timeline for d6nhgb1: