Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
Family d.185.1.1: MPP-like [63412] (7 proteins) Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal |
Protein Cytochrome bc1 core subunit 2 [63409] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [56000] (19 PDB entries) Uniprot P23004 |
Domain d6nhgb1: 6nhg B:15-235 [370756] Other proteins in same PDB: d6nhga1, d6nhga2, d6nhgc1, d6nhgc2, d6nhgd1, d6nhgd2, d6nhge1, d6nhge2, d6nhgg_, d6nhgh_, d6nhgj_, d6nhgk_ automated match to d1ntmb1 complexed with 6pe, 8pe, azo, cdl, fes, hec, hem, mc3 |
PDB Entry: 6nhg (more details), 2.8 Å
SCOPe Domain Sequences for d6nhgb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6nhgb1 d.185.1.1 (B:15-235) Cytochrome bc1 core subunit 2 {Cow (Bos taurus) [TaxId: 9913]} agvpphpqdleftrlpnglviaslenyapasriglfikagsryensnnlgtshllrlass lttkgassfkitrgieavggklsvtstrenmaytveclrddvdilmefllnvttapefrr wevaalqpqlridkavalqnpqahvienlhaaayrnalanslycpdyrigkvtpvelhdy vqnhftsarmaliglgvshpvlkqvaeqflnirgglglsga
Timeline for d6nhgb1: