SCOPe 2.07: Domain d6nhge1: 6nhg E:1-69

Lineage for d6nhge1 (6nhg E:1-69)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families)

5. Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins)

6. Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81497] (19 PDB entries)
   Uniprot P13272; precursor of chains I,E and V,R

8. Domain d6nhge1: 6nhg E:1-69 [370745]
   Other proteins in same PDB: d6nhga1, d6nhga2, d6nhgb1, d6nhgb2, d6nhgc1, d6nhgc2, d6nhgd1, d6nhgd2, d6nhge2, d6nhgg_, d6nhgh_, d6nhgj_, d6nhgk_
   automated match to d1ntme2
   complexed with 6pe, 8pe, azo, cdl, fes, hec, hem, mc3

Details for d6nhge1

PDB Entry: 6nhg, 2.8 Å

PDB Description: rhodobacter sphaeroides mitochondrial respiratory chain complex

PDB Compounds: (E:) Cytochrome b-c1 complex subunit Rieske, mitochondrial

SCOPe Domain Sequences for d6nhge1:

Sequence; same for both SEQRES and ATOM records:

>d6nhge1 f.23.12.1 (E:1-69) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Cow (Bos taurus) [TaxId: 9913]}
shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
smsasadvl

Timeline for d6nhge1:

• d6nhge1 is new in SCOPe 2.07-stable
  
• d6nhge1 appears in the current release, SCOPe 2.08