SCOP 1.61: Domain d1au3__: 1au3 -

Lineage for d1au3__ (1au3 -)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)

4. Superfamily d.3.1: Cysteine proteinases [54001] (8 families)

5. Family d.3.1.1: Papain-like [54002] (17 proteins)

6. Protein (Pro)cathepsin K [54028] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54029] (12 PDB entries)

8. Domain d1au3__: 1au3 - [37073]

Details for d1au3__

PDB Entry: 1au3, 2.5 Å

PDB Description: crystal structure of the cysteine protease human cathepsin k in complex with a covalent pyrrolidinone inhibitor

SCOP Domain Sequences for d1au3__:

Sequence; same for both SEQRES and ATOM records:

>d1au3__ d.3.1.1 (-) (Pro)cathepsin K {Human (Homo sapiens)}
apdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsen
dgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegneka
lkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwii
knswgenwgnkgyilmarnknnacgianlasfpkm

Timeline for d1au3__:

• d1au3__ first appeared (with stable ids) in SCOP 1.55
  
• d1au3__ appears in SCOP 1.59
  
• d1au3__ appears in SCOP 1.63
  
• d1au3__ appears in the current release, SCOPe 2.08, called d1au3a_