Lineage for d6mngc2 (6mng C:82-178)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2349920Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species)
  7. 2349986Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (31 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 3070631Domain d6mngc2: 6mng C:82-178 [370693]
    Other proteins in same PDB: d6mnga1, d6mnga2, d6mngb1, d6mngb2, d6mngc1
    automated match to d1d9kc1

Details for d6mngc2

PDB Entry: 6mng (more details), 2.66 Å

PDB Description: 4738 tcr bound to iab padi4
PDB Compounds: (C:) H-2 class II histocompatibility antigen, A-B alpha chain

SCOPe Domain Sequences for d6mngc2:

Sequence, based on SEQRES records: (download)

>d6mngc2 b.1.1.2 (C:82-178) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
atneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvadgvyetsffvnr
dysfhklsyltfipsdddiydckvehwgleepvlkhw

Sequence, based on observed residues (ATOM records): (download)

>d6mngc2 b.1.1.2 (C:82-178) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
atneapqatvfpkspvllgqpntlicfvdnifppvinitwlnsksvadgvyetsffvnrd
ysfhklsyltfipsydckvehwgleepvlkhw

SCOPe Domain Coordinates for d6mngc2:

Click to download the PDB-style file with coordinates for d6mngc2.
(The format of our PDB-style files is described here.)

Timeline for d6mngc2:

  • d6mngc2 appears in periodic updates to SCOPe 2.07 starting on 2019-07-21