Lineage for d6mnoc1 (6mno C:0-81)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2506503Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2506504Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2506505Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2507143Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 2507232Species Mouse (Mus musculus), I-AK [TaxId:10090] [88813] (7 PDB entries)
  8. 3070560Domain d6mnoc1: 6mno C:0-81 [370622]
    Other proteins in same PDB: d6mnoa1, d6mnoa2, d6mnob1, d6mnob2, d6mnoc2
    automated match to d1iaka2

Details for d6mnoc1

PDB Entry: 6mno (more details), 2.9 Å

PDB Description: 6235 tcr bound to i-ab padi4
PDB Compounds: (C:) H-2 class II histocompatibility antigen, A-B alpha chain

SCOPe Domain Sequences for d6mnoc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mnoc1 d.19.1.1 (C:0-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AK [TaxId: 10090]}
ieadhvgtygisvyqspgdigqytfefdgdelfyvdldkketvwmlpefgqlasfdpqgg
lqniavvkhnlgvltkrsnstp

SCOPe Domain Coordinates for d6mnoc1:

Click to download the PDB-style file with coordinates for d6mnoc1.
(The format of our PDB-style files is described here.)

Timeline for d6mnoc1:

  • d6mnoc1 appears in periodic updates to SCOPe 2.07 starting on 2019-07-21